EXPASY Translate Tool – DNA to Protein Translation

Results of Expasy Translation

Sus scrofa gap junction protein alpha 1 (GJA1), mRNA

>NM_001244212.1 Sus scrofa gap junction protein alpha 1 (GJA1), mRNA

Translate Tool – Results of translation

Open reading frames are highlighted in red. Please select one of the following frames – in the next page, you will be able to select your initiator and retrieve your amino acid sequence:

5’3′ Frame 1
T R Y Q H F S F I R G K E Stop G K Y Q T A A D F Stop T L N R Q V Stop V P E L A F S F Y F I L Stop G V

5’3′ Frame 2
R G I S T F L S L G G R S E E S T K Q Q Q T F K L Stop I D R S E C L N L L F H F T S S S E A C

5’3′ Frame 3
E V S A L F F H Stop G E G V R K V P N S S R L L N F K Stop T G L S A Stop T C F F I L L H P L R R A

3’5′ Frame 1
G T P Q R Met Stop N E K A S S G T Q T C L F K V Stop K S A A V W Y F P H S F P L Met K E K C Stop Y L

3’5′ Frame 2
A R L R G Stop S K Met K K Q V Q A L R P V Y L K F K S L L L F G T F L T P S P Stop Stop K K S A D T S

3’5′ Frame 3
H A S E D E V K Stop K S K F R H S D L S I Stop S L K V C C C L V L S S L L P P N E R K V L I P

DNA to Protein Translation

Protein sequence

Frame 1

ILLLGTAVESAWGDEQSAFRCNTQQPGCENVCYDKSFPISHVRFWVLQII 50
FVSVPTLLYLAHVFYVMRKE*SR*K*RSLSTALRSTAR*KCEG
Total length= 93

Map

1 AUCCUGCUCUUGGGCACAGCUGUUGAGUCAGCCUGGGGUGAUGAGCAGUCUGCCUUUCGU 60
————————————————————

UAGGACGAGAACCCGUGUCGACAACUCAGUCGGACCCCACUACUCGUCAGACGGAAAGCA

I  L  L  L  G  T  A  V  E  S  A  W  G  D  E  Q  S  A  F  R
S  C  S  W  A  Q  L  L  S  Q  P  G  V  M  S  S  L  P  F  V
P  A  L  G  H  S  C  *  V  S  L  G  *  *  A  V  C  L  S  L
————————————————————

D  Q  E  Q  A  C  S  N  L  *  G  P  T  I  L  L  R  G  K  T
G  A  R  P  C  L  Q  Q  T  L  R  P  H  H  A  T  Q  R  E  N
R  S  K  P  V  A  T  S  D  A  Q  P  S  S  C  D  A  K  R  Q     61 UGUAACACUCAGCAACCCGGUUGUGAAAAUGUCUGCUAUGACAAAUCCUUCCCCAUCUCU 120
————————————————————

ACAUUGUGAGUCGUUGGGCCAACACUUUUACAGACGAUACUGUUUAGGAAGGGGUAGAGA

C  N  T  Q  Q  P  G  C  E  N  V  C  Y  D  K  S  F  P  I  S
V  T  L  S  N  P  V  V  K  M  S  A  M  T  N  P  S  P  S  L
*  H  S  A  T  R  L  *  K  C  L  L  *  Q  I  L  P  H  L  S
————————————————————

T  V  S  L  L  G  T  T  F  I  D  A  I  V  F  G  E  G  D  R
Y  C  E  A  V  R  N  H  F  H  R  S  H  C  I  R  G  W  R  E
L  V  *  C  G  P  Q  S  F  T  Q  *  S  L  D  K  G  M  E  *    121 CACGUGCGUUUCUGGGUCCUGCAGAUCAUAUUUGUGUCUGUUCCUACACUCUUGUACCUG 180
————————————————————

GUGCACGCAAAGACCCAGGACGUCUAGUAUAAACACAGACAAGGAUGUGAGAACAUGGAC

H  V  R  F  W  V  L  Q  I  I  F  V  S  V  P  T  L  L  Y  L
T  C  V  S  G  S  C  R  S  Y  L  C  L  F  L  H  S  C  T  W
R  A  F  L  G  P  A  D  H  I  C  V  C  S  Y  T  L  V  P  G
————————————————————

V  H  T  E  P  D  Q  L  D  Y  K  H  R  N  R  C  E  Q  V  Q
R  A  N  R  P  G  A  S  *  I  Q  T  Q  E  *  V  R  T  G  P
T  R  K  Q  T  R  C  I  M  N  T  D  T  G  V  S  K  Y  R  A    181 GCUCAUGUGUUCUACGUGAUGCGAAAGGAAUAAAGCAGAUAGAAAUAAAGAAGUUUAAGU 240
————————————————————

CGAGUACACAAGAUGCACUACGCUUUCCUUAUUUCGUCUAUCUUUAUUUCUUCAAAUUCA

A  H  V  F  Y  V  M  R  K  E  *  S  R  *  K  *  R  S  L  S
L  M  C  S  T  *  C  E  R  N  K  A  D  R  N  K  E  V  *  V
S  C  V  L  R  D  A  K  G  I  K  Q  I  E  I  K  K  F  K  Y
————————————————————

S  M  H  E  V  H  H  S  L  F  L  A  S  L  F  L  S  T  *  T
E  H  T  R  R  S  A  F  P  I  F  C  I  S  I  F  F  N  L  Y
*  T  N  *  T  I  R  F  S  Y  L  L  Y  F  Y  L  L  K  L  V    241 ACGGCAUUGAGGAGCACGGCAAGGUGAAAAUGCGAGGGGG 280
—————————————-

UGCCGUAACUCCUCGUGCCGUUCCACUUUUACGCUCCCCC

T  A  L  R  S  T  A  R  *  K  C  E  G
R  H  *  G  A  R  Q  G  E  N  A  R  G
G  I  E  E  H  G  K  V  K  M  R  G
—————————————-

R  C  Q  P  A  R  C  P  S  F  A  L  P
P  M  S  S  C  P  L  T  F  I  R  P  P
A  N  L  L  V  A  L  H  F

    MBOSS TRANSEQ

Sus scrofa gap junction protein alpha 1 (GJA1), mRNA

>NM_001244212.1 Sus scrofa gap junction protein alpha 1 (GJA1), mRNA

ACGAGGTATCAGCACTTTTCTTTCATTAGGGGGAAGGAGTGAGGAAAGTACCAAACAGCAGCAGACTTTT

AAACTTTAAATAGACAGGTCTGAGTGCCTGAACTTGCTTTTTCATTTTACTTCATCCTCTGAGGCGTGCC

TACTTCACTTCTTTTAAGGGAAAGAGTAGTGTCCGGGCAACATGGGTGACTGGAGTGCCTTAGGCAAACT

CCTTGACAAGGTTCAAGCCTATTCCACCGCTGGAGGGAAGGTGTGGCTGTCAGTCCTTTTCATTTTCCGA

ATCCTGCTCTTGGGCACAGCTGTTGAGTCAGCCTGGGGTGATGAGCAGTCTGCCTTTCGTTGTAACACTC

AGCAACCCGGTTGTGAAAATGTCTGCTATGACAAATCCTTCCCCATCTCTCACGTGCGTTTCTGGGTCCT

GCAGATCATATTTGTGTCTGTTCCTACACTCTTGTACCTGGCTCATGTGTTCTACGTGATGCGAAAGGAA

GAGAAACTGAACAAGAAAGAGGAGGAACTCAAAGTTGCCCAAACTGACGGTGTCAACGTGGAGATGCACT

TAAAGCAGATAGAAATAAAGAAGTTTAAGTACGGCATTGAGGAGCACGGCAAGGTGAAAATGCGAGGGGG

CTTGCTGCGAACCTACATCATCAGTATCCTCTTCAAGTCTGTCTTCGAGGTGGCCTTCTTGCTGATCCAA

TGGTACATCTATGGATTCAGCCTGAGTGCTGTTTACACTTGCAAAAGAGATCCCTGCCCGCACCAGGTGG

ACTGTTTCCTCTCTCGTCCCACGGAGAAAACCATCTTCATCATCTTCATGCTGGTCGTATCCTTGGTGTC

TCTCGCCTTGAACATCATCGAACTCTTCTATGTCTTCTTCAAGGGTGTTAAGGATCGTGTGAAGGGAAAG

AGTGATCCTTACCACGCCACCACCGGTCCACTGAGCCCCTCCAAAGACTGTGGATCTCCAAAATACGCTT

ATTTCAATGGCTGCTCCTCACCAACTGCTCCGCTCTCACCCATGTCCCCTCCCGGATACAAGCTGGTTAC

CGGAGACAGAAACAATTCTTCCTGCCGCAATTACAACAAACAAGCGAGTGAGCAAAACTGGGCTAATTAC

AGTGCCGAGCAGAATCGAATGGGGCAGGCAGGAAGCACCATCTCTAACTCCCATGCACAGCCTTTTGATT

TCCCCGATGACAACCAGAATTCTAAAAAACTCGATGCTGGCCATGAACTCCAGCCTCTAGCCATTGTGGA

CCAGCGGCCTTCCAGCAGAGCCAGCAGTCGCGCCAGCAGCCGACCTCGGCCTGATGACCTGGAGATCTAG

AGCCAATCTTGAGAACATCAAGATTCCACTCAGTTGTGGAGAAGAAAAAGGTGCTATAGAAAGTGCACCT

TAGGTGTTCATTTTTTTTCCAGTGGAGGTGGTACTCAACAGCCTTGTCACAAGGCTTAGAAAACACAAAG

ACATTAGAATACCTGGTTCATAGGGGGTGTTAGGGATAGGTGGGTGGAGAGGGAGGGGATGAGGGAGGTA

CAGGTTGGTATTTAATGTAGTTGACTTAAAGAACTTAAGTTCTAAATAACAGTTGCATTAGGTGATCTAT

AGGTAAGGGCTTTTTCTCCTCCCCATACCCTTAAGAATAGCTCTGTGTATGTGAAAGAGTGGGTGATGTT

TTTGGCTAAATACTTTTTTCATTTTACCAAGAAACTGAAATAACTTTGGCCAGGAGAAAATACTTCCTGA

ACATTTTATTTCTCTTTTTCAAGAAAAAGACAGAGGATTTTCCTTGAGTCCCTGCTAAAACATTCCATTG

TTAAAATTTGCACTTTGAAGGTAAGCTTTTTAGGCCTGACCCTCCAGGTGTCAATGGACTTGTGCTACTA

TATTTTTTAATCTTGGTATCAGTTAAAAGTTCAGACAAGGCCCACAGAAAAAGATGTTCCAAGCATTTGC

AAATCTCAGCCGGTTACACAAACCTTCTTTTTTACATCCACTTGCTTATATTATTACCATCACTTTACGT

CATTCCTCAACTACTATCACATCCATTTAATGATTTCTGTAAACATTTTTTAAACAGTTAGGATGTCACT

TAACATTTTTTGAGTTAGAGTCAGGGAAGCAAGCCATGCTCAATATTTAACAATCACTTGTATGTATATG

TTTGTGGAAGAGTGTGTTTTATTTGTCATGTATTGGTACAAGCAGATGCAGTATAAACTCACAAACACAG

ATTTGAAAATAATGCACACAGTGTTCAAATTTGAACTTTTCTCATGGATTTCATGGTATGGGCCAACATG

GTGTTTACATTATATAATTCCTGCTGTGCAAGTAAAGCACACTTTTTTTTCCCTAAAATTTTTTTTCCCC

ATGTATCCTATTATGGATACTAGTTTTGTTAATTATGATTCTTTTTTTTCTCTTTTCTTTTTTTTTAGAA

TATAGCAGTTAATGCTATTGCTGAAATGAATGATTTTTTTTTCTGAAATATAATCATTGATGCTTGAATG

ATAGAATTTTAGTACTGTAAACAGGCTTTAGTAATTAATGTGAGAGACTTAGAAGAAATGCTTAGAATGG

ACTATTGAGTGTGCCTAAATGAATTCTGCAGTAACTGGTATTCTTGGTTTTGTGCTACTTAATACACATT

AATTCAGAAACTGTATTCTGTTATGAGTTTGACAGTCTTTTGGAGCAACCAACAACTTTGATGTTTGCAC

TAAGATTTTATTTGGAATGCAAGAGAGGTTGAAAGAGCTTTCAGTAGTACACATGTAACTAATTTATTTG

AAATCTGTCCTAAAGAAATCTACCAGTTTGTTCAAATGCCTTTTTAAAATTCATCACAGATAATTAGTGA

AAACGCAGAGTATCGTACTTTTCTTCTTGCATGTCAACAACATAAACAGTTTTGTACAATGAGAAATACT

AATTTGTTTGACATTCCATATTAAACTACTGTCATGTTCAGCTTCATTGCATGTAATGTAGACTAGTCCA

TCAGATCATGTGTTTCTGGAGAGTGTTCTTTATTCAATAAAGTTTTAATTTAGTATAAAGAGAGCCTCTA

AAAAAAAAAAAAAAAAA

Leave a Comment